Class a: All alpha proteins [46456] (290 folds) |
Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family) |
Family a.223.1.0: automated matches [256442] (1 protein) not a true family |
Protein automated matches [256443] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [342133] (2 PDB entries) |
Domain d5owib3: 5owi B:248-432 [342134] Other proteins in same PDB: d5owia1, d5owia2, d5owib1, d5owib2 automated match to d1w26a1 |
PDB Entry: 5owi (more details)
SCOPe Domain Sequences for d5owib3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5owib3 a.223.1.0 (B:248-432) automated matches {Escherichia coli [TaxId: 562]} ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel mnqqa
Timeline for d5owib3: