SCOPe 2.08: Domain d5owia2: 5owi A:132-247

Lineage for d5owia2 (5owi A:132-247)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225399] (3 PDB entries)

8. Domain d5owia2: 5owi A:132-247 [342141]
   Other proteins in same PDB: d5owia1, d5owia3, d5owib1, d5owib3
   automated match to d1w26a3

Details for d5owia2

PDB Entry: 5owi

PDB Description: the dynamic dimer structure of the chaperone trigger factor (conformer 1)

PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d5owia2:

Sequence; same for both SEQRES and ATOM records:

>d5owia2 d.26.1.0 (A:132-247) automated matches {Escherichia coli [TaxId: 562]}
vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq
grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe

Timeline for d5owia2:

• d5owia2 first appeared in SCOPe 2.06
  
• d5owia2 appears in SCOPe 2.07