SCOPe 2.06: Domain d5m2da_: 5m2d A:

Lineage for d5m2da_ (5m2d A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (15 species)
   not a true protein

7. Species Acremonium chrysogenum [TaxId:857340] [342079] (1 PDB entry)

8. Domain d5m2da_: 5m2d A: [342082]
   automated match to d1oa2a_
   complexed with gol

Details for d5m2da_

PDB Entry: 5m2d, 2.1 Å

PDB Description: crystal structure 4ac endoglucanase-like protein from acremonium chrysogenum

PDB Compounds: (A:) Endoglucanase-like protein

SCOPe Domain Sequences for d5m2da_:

Sequence; same for both SEQRES and ATOM records:

>d5m2da_ b.29.1.11 (A:) automated matches {Acremonium chrysogenum [TaxId: 857340]}
qqlceqygyhaangyyfnnnmwgqgsgsgsqcltvdsaqsggvswhvdwqwsggqnnvks
ypyagrelpqkrlvssigsiptsaswgysgnnlranvaydlftaadpnhetssgdyelmi
wlgrlgdvypigssvgfvnvggqqwelfdgyngnmhvfsfvapqqinnfntdvktffdyl
twnrgfpadqqhllilqfgtepftggpatfqvnhfsgqvn

Timeline for d5m2da_:

• d5m2da_ is new in SCOPe 2.06-stable
  
• d5m2da_ appears in SCOPe 2.07
  
• d5m2da_ appears in the current release, SCOPe 2.08