![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
![]() | Protein automated matches [190135] (18 species) not a true protein |
![]() | Species Acremonium chrysogenum [TaxId:857340] [342079] (1 PDB entry) |
![]() | Domain d5m2da_: 5m2d A: [342082] automated match to d1oa2a_ complexed with gol |
PDB Entry: 5m2d (more details), 2.1 Å
SCOPe Domain Sequences for d5m2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m2da_ b.29.1.11 (A:) automated matches {Acremonium chrysogenum [TaxId: 857340]} qqlceqygyhaangyyfnnnmwgqgsgsgsqcltvdsaqsggvswhvdwqwsggqnnvks ypyagrelpqkrlvssigsiptsaswgysgnnlranvaydlftaadpnhetssgdyelmi wlgrlgdvypigssvgfvnvggqqwelfdgyngnmhvfsfvapqqinnfntdvktffdyl twnrgfpadqqhllilqfgtepftggpatfqvnhfsgqvn
Timeline for d5m2da_: