Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein automated matches [190135] (18 species) not a true protein |
Species Acremonium chrysogenum [TaxId:857340] [342079] (1 PDB entry) |
Domain d5m2db_: 5m2d B: [342080] automated match to d1oa2a_ complexed with gol |
PDB Entry: 5m2d (more details), 2.1 Å
SCOPe Domain Sequences for d5m2db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m2db_ b.29.1.11 (B:) automated matches {Acremonium chrysogenum [TaxId: 857340]} qqlceqygyhaangyyfnnnmwgqgsgsgsqcltvdsaqsggvswhvdwqwsggqnnvks ypyagrelpqkrlvssigsiptsaswgysgnnlranvaydlftaadpnhetssgdyelmi wlgrlgdvypigssvgfvnvggqqwelfdgyngnmhvfsfvapqqinnfntdvktffdyl twnrgfpadqqhllilqfgtepftggpatfqvnhfsgqvn
Timeline for d5m2db_: