Lineage for d5m2db_ (5m2d B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780262Species Acremonium chrysogenum [TaxId:857340] [342079] (1 PDB entry)
  8. 2780264Domain d5m2db_: 5m2d B: [342080]
    automated match to d1oa2a_
    complexed with gol

Details for d5m2db_

PDB Entry: 5m2d (more details), 2.1 Å

PDB Description: crystal structure 4ac endoglucanase-like protein from acremonium chrysogenum
PDB Compounds: (B:) Endoglucanase-like protein

SCOPe Domain Sequences for d5m2db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2db_ b.29.1.11 (B:) automated matches {Acremonium chrysogenum [TaxId: 857340]}
qqlceqygyhaangyyfnnnmwgqgsgsgsqcltvdsaqsggvswhvdwqwsggqnnvks
ypyagrelpqkrlvssigsiptsaswgysgnnlranvaydlftaadpnhetssgdyelmi
wlgrlgdvypigssvgfvnvggqqwelfdgyngnmhvfsfvapqqinnfntdvktffdyl
twnrgfpadqqhllilqfgtepftggpatfqvnhfsgqvn

SCOPe Domain Coordinates for d5m2db_:

Click to download the PDB-style file with coordinates for d5m2db_.
(The format of our PDB-style files is described here.)

Timeline for d5m2db_: