Lineage for d6baba_ (6bab A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2591262Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2591263Protein automated matches [190417] (35 species)
    not a true protein
  7. 2593521Species Mouse (Mus musculus) [TaxId:10090] [194605] (30 PDB entries)
  8. 2593531Domain d6baba_: 6bab A: [342037]
    automated match to d2vn9a_
    complexed with d0s, tla

Details for d6baba_

PDB Entry: 6bab (more details), 1.91 Å

PDB Description: the structure of human camkii with bound inhibitor
PDB Compounds: (A:) Calcium/calmodulin-dependent protein kinase type II subunit delta

SCOPe Domain Sequences for d6baba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6baba_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqklerearicrllkh
pnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhchln
givhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrkdp
ygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdlin
kmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrkl

SCOPe Domain Coordinates for d6baba_:

Click to download the PDB-style file with coordinates for d6baba_.
(The format of our PDB-style files is described here.)

Timeline for d6baba_: