Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [194605] (30 PDB entries) |
Domain d6babc_: 6bab C: [342036] automated match to d2vn9a_ complexed with d0s, tla |
PDB Entry: 6bab (more details), 1.91 Å
SCOPe Domain Sequences for d6babc_:
Sequence, based on SEQRES records: (download)
>d6babc_ d.144.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqklerearicrllkhpn ivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhchlngi vhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrkdpyg kpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdlinkm ltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrkl
>d6babc_ d.144.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eyqlfeelgkgafsvvrrcmkqeyaakiintkklsardhqklerearicrllkhpnivrl hdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhchlngivhrd lkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrkdpygkpvd mwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdlinkmltin pakritasealkhpwicqrstvasmmhrqetvdclkkfnarrkl
Timeline for d6babc_: