Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
Domain d5xlze_: 5xlz E: [341960] Other proteins in same PDB: d5xlza1, d5xlza2, d5xlzb1, d5xlzb2, d5xlzc1, d5xlzc2, d5xlzd1, d5xlzd2, d5xlzf1, d5xlzf2, d5xlzf3 automated match to d4i55e_ complexed with 89u, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5xlz (more details), 2.3 Å
SCOPe Domain Sequences for d5xlze_:
Sequence, based on SEQRES records: (download)
>d5xlze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d5xlze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d5xlze_: