SCOPe 2.08: Domain d5xlzc2: 5xlz C:246-440

Lineage for d5xlzc2 (5xlz C:246-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d5xlzc2: 5xlz C:246-440 [341957]
   Other proteins in same PDB: d5xlza1, d5xlzb1, d5xlzc1, d5xlzd1, d5xlze_, d5xlzf1, d5xlzf2, d5xlzf3
   automated match to d4i50a2
   complexed with 89u, acp, ca, gdp, gtp, mes, mg

Details for d5xlzc2

PDB Entry: 5xlz, 2.3 Å

PDB Description: the crystal structure of tubulin complexed with a benzylidene derivative of 9(10h)-anthracenone

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5xlzc2:

Sequence; same for both SEQRES and ATOM records:

>d5xlzc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5xlzc2:

• d5xlzc2 first appeared in SCOPe 2.06
  
• d5xlzc2 appears in SCOPe 2.07