SCOPe 2.07: Domain d5p9rb_: 5p9r B:

Lineage for d5p9rb_ (5p9r B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.1: COMT-like [53336] (4 proteins)

6. Protein Catechol O-methyltransferase, COMT [53337] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries)

8. Domain d5p9rb_: 5p9r B: [341878]
   automated match to d4pyna_
   complexed with 7jj, cl, mg, na, sah

Details for d5p9rb_

PDB Entry: 5p9r, 1.7 Å

PDB Description: humanized rat comt in complex with 5-chloro-6-(4-fluorophenyl)-8- hydroxy-3h-quinazolin-4-one

PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5p9rb_:

Sequence; same for both SEQRES and ATOM records:

>d5p9rb_ c.66.1.1 (B:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl
vlelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqd
lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla
yvrgsssfecthyssyleymkvvdglekaiyqgp

Timeline for d5p9rb_:

• d5p9rb_ first appeared in SCOPe 2.06
  
• d5p9rb_ appears in the current release, SCOPe 2.08