| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (2 families) ![]() |
| Family c.65.1.1: Formyltransferase [53329] (4 proteins) |
| Protein Methionyl-tRNAfmet formyltransferase [53332] (2 species) |
| Species Escherichia coli [TaxId:562] [53333] (2 PDB entries) |
| Domain d2fmtb2: 2fmt B:1-206 [34177] Other proteins in same PDB: d2fmta1, d2fmtb1 protein/RNA complex; complexed with fme, mg |
PDB Entry: 2fmt (more details), 2.8 Å
SCOPe Domain Sequences for d2fmtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmtb2 c.65.1.1 (B:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]}
seslriifagtpdfaarhldallssghnvvgvftqpdrpagrgkklmpspvkvlaeekgl
pvfqpvslrpqenqqlvaelqadvmvvvayglilpkavlemprlgcinvhgsllprwrga
apiqrslwagdaetgvtimqmdvgldtgdmlyklscpitaedtsgtlydklaelgpqgli
ttlkqladgtakpevqdetlvtyaek
Timeline for d2fmtb2: