Lineage for d2fmtb2 (2fmt B:1-206)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378380Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 1378381Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 1378382Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 1378442Protein Methionyl-tRNAfmet formyltransferase [53332] (2 species)
  7. 1378445Species Escherichia coli [TaxId:562] [53333] (2 PDB entries)
  8. 1378449Domain d2fmtb2: 2fmt B:1-206 [34177]
    Other proteins in same PDB: d2fmta1, d2fmtb1
    protein/RNA complex; complexed with fme, mg

Details for d2fmtb2

PDB Entry: 2fmt (more details), 2.8 Å

PDB Description: methionyl-trnafmet formyltransferase complexed with formyl-methionyl- trnafmet
PDB Compounds: (B:) methionyl-tRNA fmet formyltransferase

SCOPe Domain Sequences for d2fmtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmtb2 c.65.1.1 (B:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]}
seslriifagtpdfaarhldallssghnvvgvftqpdrpagrgkklmpspvkvlaeekgl
pvfqpvslrpqenqqlvaelqadvmvvvayglilpkavlemprlgcinvhgsllprwrga
apiqrslwagdaetgvtimqmdvgldtgdmlyklscpitaedtsgtlydklaelgpqgli
ttlkqladgtakpevqdetlvtyaek

SCOPe Domain Coordinates for d2fmtb2:

Click to download the PDB-style file with coordinates for d2fmtb2.
(The format of our PDB-style files is described here.)

Timeline for d2fmtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fmtb1