Class a: All alpha proteins [46456] (290 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [259659] (4 PDB entries) |
Domain d5orfc2: 5orf C:196-387 [341730] automated match to d3uiva1 complexed with peg, pge, pro |
PDB Entry: 5orf (more details), 2.54 Å
SCOPe Domain Sequences for d5orfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5orfc2 a.126.1.0 (C:196-387) automated matches {Sheep (Ovis aries) [TaxId: 9940]} rlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhkecchgdllecadd radlakyicdhqdalssklkeccdkpvlekshciaevdkdavpenlppltadfaedkevc knyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccakedphacyatvfdk lkhlvdepqnli
Timeline for d5orfc2: