PDB entry 5orf

View 5orf on RCSB PDB site
Description: Structure of ovine serum albumin in P1 space group
Class: transport protein
Keywords: ovine serum albumin, triclinic system, TRANSPORT PROTEIN
Deposited on 2017-08-16, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5orfa1, d5orfa2, d5orfa3
  • Chain 'B':
    Compound: serum albumin
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5orfb1, d5orfb2, d5orfb3
  • Chain 'C':
    Compound: serum albumin
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5orfc1, d5orfc2, d5orfc3
  • Chain 'D':
    Compound: serum albumin
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5orfd1, d5orfd2, d5orfd3
  • Heterogens: PGE, PEG, PRO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5orfA (A:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflnhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    idamrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdalssklkeccdkpvlekshciaevdkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdekfftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfvlegpklvastqaala
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5orfB (B:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflnhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    idamrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdalssklkeccdkpvlekshciaevdkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdekfftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfvlegpklvastqaala
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5orfC (C:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflnhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    idamrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdalssklkeccdkpvlekshciaevdkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdekfftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfvlegpklvastqaala
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5orfD (D:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflnhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    idamrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdalssklkeccdkpvlekshciaevdkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdekfftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfvlegpklvastqaala