Lineage for d1poib_ (1poi B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1012147Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1012148Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1012242Family c.124.1.3: CoA transferase beta subunit-like [74657] (3 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 1012243Protein Glutaconate:CoA transferase beta [53320] (1 species)
  7. 1012244Species Acidaminococcus fermentans [TaxId:905] [53321] (1 PDB entry)
  8. 1012245Domain d1poib_: 1poi B: [34155]
    Other proteins in same PDB: d1poia_, d1poic_
    complexed with cu

Details for d1poib_

PDB Entry: 1poi (more details), 2.5 Å

PDB Description: crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution
PDB Compounds: (B:) glutaconate coenzyme a-transferase

SCOPe Domain Sequences for d1poib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poib_ c.124.1.3 (B:) Glutaconate:CoA transferase beta {Acidaminococcus fermentans [TaxId: 905]}
dytnytnkemqavtiakqikngqvvtvgtglpligasvakrvyapdchiivesglmdcsp
vevprsvgdlrfmahcgciwpnvrfvgfeineylhkanrliafiggaqidpygnvnstsi
gdyhhpktrftgsggangiatysntiimmqhekrrfmnkidyvtspgwidgpggrerlgl
pgdvgpqlvvtdkgilkfdektkrmylaayyptsspedvlentgfdldvskaveleapdp
aviklireeidpgqafiqvp

SCOPe Domain Coordinates for d1poib_:

Click to download the PDB-style file with coordinates for d1poib_.
(The format of our PDB-style files is described here.)

Timeline for d1poib_: