SCOP 1.75: Domain d1poib_: 1poi B:

Lineage for d1poib_ (1poi B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (8 families)

5. Family c.124.1.3: CoA transferase beta subunit-like [74657] (3 proteins)
   catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest

6. Protein Glutaconate:CoA transferase beta [53320] (1 species)

7. Species Acidaminococcus fermentans [TaxId:905] [53321] (1 PDB entry)

8. Domain d1poib_: 1poi B: [34155]
   Other proteins in same PDB: d1poia_, d1poic_

Details for d1poib_

PDB Entry: 1poi, 2.5 Å

PDB Description: crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution

PDB Compounds: (B:) glutaconate coenzyme a-transferase

SCOP Domain Sequences for d1poib_:

Sequence; same for both SEQRES and ATOM records:

>d1poib_ c.124.1.3 (B:) Glutaconate:CoA transferase beta {Acidaminococcus fermentans [TaxId: 905]}
dytnytnkemqavtiakqikngqvvtvgtglpligasvakrvyapdchiivesglmdcsp
vevprsvgdlrfmahcgciwpnvrfvgfeineylhkanrliafiggaqidpygnvnstsi
gdyhhpktrftgsggangiatysntiimmqhekrrfmnkidyvtspgwidgpggrerlgl
pgdvgpqlvvtdkgilkfdektkrmylaayyptsspedvlentgfdldvskaveleapdp
aviklireeidpgqafiqvp

Timeline for d1poib_:

• d1poib_ first appeared (with stable ids) in SCOP 1.55
  
• d1poib_ appears in SCOP 1.73
  
• d1poib_ appears in SCOPe 2.01
  
• d1poib_ appears in the current release, SCOPe 2.08