Lineage for d1aoxb_ (1aox B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247390Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 247391Superfamily c.62.1: vWA-like [53300] (2 families) (S)
  5. 247392Family c.62.1.1: Integrin A (or I) domain [53301] (8 proteins)
  6. 247403Protein Integrin alpha2-beta1 [53313] (1 species)
  7. 247404Species Human (Homo sapiens) [TaxId:9606] [53314] (2 PDB entries)
  8. 247406Domain d1aoxb_: 1aox B: [34152]
    complexed with mg; mutant

Details for d1aoxb_

PDB Entry: 1aox (more details), 2.1 Å

PDB Description: i domain from integrin alpha2-beta1

SCOP Domain Sequences for d1aoxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoxb_ c.62.1.1 (B:) Integrin alpha2-beta1 {Human (Homo sapiens)}
rsscpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfn
lntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdge
shdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvs
deaallekagtlgeqifsieg

SCOP Domain Coordinates for d1aoxb_:

Click to download the PDB-style file with coordinates for d1aoxb_.
(The format of our PDB-style files is described here.)

Timeline for d1aoxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aoxa_