SCOP 1.65: Domain d1aoxb_: 1aox B:

Lineage for d1aoxb_ (1aox B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (2 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (8 proteins)

6. Protein Integrin alpha2-beta1 [53313] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53314] (2 PDB entries)

8. Domain d1aoxb_: 1aox B: [34152]
   complexed with mg; mutant

Details for d1aoxb_

PDB Entry: 1aox, 2.1 Å

PDB Description: i domain from integrin alpha2-beta1

SCOP Domain Sequences for d1aoxb_:

Sequence; same for both SEQRES and ATOM records:

>d1aoxb_ c.62.1.1 (B:) Integrin alpha2-beta1 {Human (Homo sapiens)}
rsscpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfn
lntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdge
shdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvs
deaallekagtlgeqifsieg

Timeline for d1aoxb_:

• d1aoxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1aoxb_ appears in SCOP 1.63
  
• d1aoxb_ appears in SCOP 1.67
  
• d1aoxb_ appears in the current release, SCOPe 2.08