Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (30 species) not a true protein |
Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries) |
Domain d5lwfb_: 5lwf B: [341504] Other proteins in same PDB: d5lwfc1, d5lwfc2, d5lwfd1, d5lwfd2 automated match to d2blma_ complexed with act |
PDB Entry: 5lwf (more details), 2.56 Å
SCOPe Domain Sequences for d5lwfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lwfb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]} ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr kigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrellidwm krnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdak yddkliaeatkvvmkaln
Timeline for d5lwfb_: