Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries) |
Domain d5lwfd1: 5lwf D:9-126 [341554] Other proteins in same PDB: d5lwfa_, d5lwfb_, d5lwfc2, d5lwfd2 automated match to d5da4a_ complexed with act |
PDB Entry: 5lwf (more details), 2.56 Å
SCOPe Domain Sequences for d5lwfd1:
Sequence, based on SEQRES records: (download)
>d5lwfd1 b.1.1.1 (D:9-126) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyadsvk grfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvtv
>d5lwfd1 b.1.1.1 (D:9-126) automated matches {Llama (Lama glama) [TaxId: 9844]} esgvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyadsvkgrf afsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvtv
Timeline for d5lwfd1:
View in 3D Domains from other chains: (mouse over for more information) d5lwfa_, d5lwfb_, d5lwfc1, d5lwfc2 |