SCOPe 2.07: Domain d4giba1: 4gib A:1-224

Lineage for d4giba1 (4gib A:1-224)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [188776] (3 PDB entries)

8. Domain d4giba1: 4gib A:1-224 [341461]
   Other proteins in same PDB: d4giba2
   automated match to d3nasb_
   complexed with gly, na, po4

Details for d4giba1

PDB Entry: 4gib, 2.27 Å

PDB Description: 2.27 angstrom crystal structure of beta-phosphoglucomutase (pgmb) from clostridium difficile

PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d4giba1:

Sequence; same for both SEQRES and ATOM records:

>d4giba1 c.108.1.0 (A:1-224) automated matches {Clostridium difficile [TaxId: 272563]}
mieafifdldgvitdtayyhymawrklahkvgididtkfneslkgisrmesldrilefgn
kkysfseeekvrmaeeknnyyvslideitsndilpgiesllidvksnnikiglssaskna
invlnhlgisdkfdfiadagkcknnkphpeiflmsakglnvnpqncigiedasagidain
sanmfsvgvgnyenlkkanlvvdstnqlkfeyiqekyneyivrr

Timeline for d4giba1:

• d4giba1 first appeared in SCOPe 2.06
  
• d4giba1 appears in the current release, SCOPe 2.08