Lineage for d4gibb_ (4gib B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527523Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2527524Protein automated matches [190447] (55 species)
    not a true protein
  7. 2527637Species Clostridium difficile [TaxId:272563] [188776] (3 PDB entries)
  8. 2527642Domain d4gibb_: 4gib B: [341460]
    Other proteins in same PDB: d4giba2
    automated match to d3nasb_
    complexed with gly, na, po4

Details for d4gibb_

PDB Entry: 4gib (more details), 2.27 Å

PDB Description: 2.27 angstrom crystal structure of beta-phosphoglucomutase (pgmb) from clostridium difficile
PDB Compounds: (B:) beta-phosphoglucomutase

SCOPe Domain Sequences for d4gibb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gibb_ c.108.1.0 (B:) automated matches {Clostridium difficile [TaxId: 272563]}
mieafifdldgvitdtayyhymawrklahkvgididtkfneslkgisrmesldrilefgn
kkysfseeekvrmaeeknnyyvslideitsndilpgiesllidvksnnikiglssaskna
invlnhlgisdkfdfiadagkcknnkphpeiflmsakglnvnpqncigiedasagidain
sanmfsvgvgnyenlkkanlvvdstnqlkfeyiqekyneyivr

SCOPe Domain Coordinates for d4gibb_:

Click to download the PDB-style file with coordinates for d4gibb_.
(The format of our PDB-style files is described here.)

Timeline for d4gibb_: