Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [188776] (3 PDB entries) |
Domain d4gibb_: 4gib B: [341460] Other proteins in same PDB: d4giba2 automated match to d3nasb_ complexed with gly, na, po4 |
PDB Entry: 4gib (more details), 2.27 Å
SCOPe Domain Sequences for d4gibb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gibb_ c.108.1.0 (B:) automated matches {Clostridium difficile [TaxId: 272563]} mieafifdldgvitdtayyhymawrklahkvgididtkfneslkgisrmesldrilefgn kkysfseeekvrmaeeknnyyvslideitsndilpgiesllidvksnnikiglssaskna invlnhlgisdkfdfiadagkcknnkphpeiflmsakglnvnpqncigiedasagidain sanmfsvgvgnyenlkkanlvvdstnqlkfeyiqekyneyivr
Timeline for d4gibb_: