Lineage for d1bho2_ (1bho 2:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999157Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 999158Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 999159Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 999172Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 999173Species Human (Homo sapiens) [TaxId:9606] [53309] (10 PDB entries)
  8. 999182Domain d1bho2_: 1bho 2: [34144]
    complexed with mg

Details for d1bho2_

PDB Entry: 1bho (more details), 2.7 Å

PDB Description: mac-1 i domain magnesium complex
PDB Compounds: (2:) cd11b

SCOPe Domain Sequences for d1bho2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bho2_ c.62.1.1 (2:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
rekifaieg

SCOPe Domain Coordinates for d1bho2_:

Click to download the PDB-style file with coordinates for d1bho2_.
(The format of our PDB-style files is described here.)

Timeline for d1bho2_: