SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1bho2_ (1bho 2:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128912Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128913Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2128914Family c.62.1.1: Integrin A (or I) domain [53301] (11 protein domains)
  6. 2128927Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 2128928Species Human (Homo sapiens) [TaxId:9606] [53309] (12 PDB entries)
  8. 2128937Domain d1bho2_: 1bho 2: [34144]
    complexed with mg

Details for d1bho2_

PDB Entry: 1bho (more details), 2.7 Å

PDB Description: mac-1 i domain magnesium complex
PDB Compounds: (2:) cd11b

SCOPe Domain Sequences for d1bho2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bho2_ c.62.1.1 (2:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
rekifaieg

SCOPe Domain Coordinates for d1bho2_:

Click to download the PDB-style file with coordinates for d1bho2_.
(The format of our PDB-style files is described here.)

Timeline for d1bho2_: