Lineage for d1idn1_ (1idn 1:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183302Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 183303Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 183304Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins)
  6. 183334Protein Integrin CR3 (CD11b/CD18, Mac-1), alpha subunit [53308] (1 species)
  7. 183335Species Human (Homo sapiens) [TaxId:9606] [53309] (6 PDB entries)
  8. 183339Domain d1idn1_: 1idn 1: [34141]

Details for d1idn1_

PDB Entry: 1idn (more details), 2.7 Å

PDB Description: mac-1 i domain metal free

SCOP Domain Sequences for d1idn1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idn1_ c.62.1.1 (1:) Integrin CR3 (CD11b/CD18, Mac-1), alpha subunit {Human (Homo sapiens)}
sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
rekifaieg

SCOP Domain Coordinates for d1idn1_:

Click to download the PDB-style file with coordinates for d1idn1_.
(The format of our PDB-style files is described here.)

Timeline for d1idn1_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1idn2_