Lineage for d1idn1_ (1idn 1:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.62: Integrin A (or I) domain [53299] (1 superfamily) Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) 
Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins) 
Protein Integrin CR3 (CD11b/CD18, Mac-1), alpha subunit [53308] (1 species) Species Human (Homo sapiens) [TaxId:9606] [53309] (5 PDB entries) 
Domain d1idn1_: 1idn 1: [34141]
Details for d1idn1_
PDB Entry: 1idn (more details), 2.7 Å
PDB Description: mac-1 i domain metal free
SCOP Domain Sequences for d1idn1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1idn1_ c.62.1.1 (1:) Integrin CR3 (CD11b/CD18, Mac-1), alpha subunit {Human (Homo sapiens)}
sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
rekifaieg
SCOP Domain Coordinates for d1idn1_:
Click to download the PDB-style file with coordinates for d1idn1_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1idn1_:
- d1idn1_ first appeared (with stable ids) in SCOP 1.55
- d1idn1_ appears in SCOP 1.57
- d1idn1_ appears in SCOP 1.61
- d1idn1_ appears in the current release, SCOPe 2.08
View in 3D
