SCOPe 2.08: Domain d5pgud1: 5pgu D:24-283

Lineage for d5pgud1 (5pgu D:24-283)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186828] (21 PDB entries)

8. Domain d5pgud1: 5pgu D:24-283 [341178]
   Other proteins in same PDB: d5pgub2, d5pgud2
   automated match to d3dwfc1
   complexed with 8k4, nap; mutant

Details for d5pgud1

PDB Entry: 5pgu, 2.35 Å

PDB Description: crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with 2-[2-(4-fluorophenyl)-2-adamantyl]-1-(3- methoxyazetidin-1-yl)ethanone

PDB Compounds: (D:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d5pgud1:

Sequence; same for both SEQRES and ATOM records:

>d5pgud1 c.2.1.2 (D:24-283) automated matches {Human (Homo sapiens) [TaxId: 9606]}
neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrw
ttllirnpcrkileelysts

Timeline for d5pgud1:

• d5pgud1 first appeared in SCOPe 2.06
  
• d5pgud1 appears in SCOPe 2.07