Lineage for d5xjfb1 (5xjf B:230-339)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362783Domain d5xjfb1: 5xjf B:230-339 [341171]
    Other proteins in same PDB: d5xjfc1, d5xjfc2
    automated match to d1hzhk3
    complexed with bma, cl, fuc, gal, man, nag; mutant

Details for d5xjfb1

PDB Entry: 5xjf (more details), 2.5 Å

PDB Description: crystal structure of fucosylated igg fc y296w mutant complexed with bis-glycosylated soluble form of fc gamma receptor iiia
PDB Compounds: (B:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d5xjfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xjfb1 b.1.1.2 (B:230-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
papellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnakt
kpreeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d5xjfb1:

Click to download the PDB-style file with coordinates for d5xjfb1.
(The format of our PDB-style files is described here.)

Timeline for d5xjfb1: