Lineage for d1upud_ (1upu D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891628Protein Uracil PRTase, Upp [53293] (5 species)
  7. 2891665Species Toxoplasma gondii [TaxId:5811] [53295] (6 PDB entries)
  8. 2891681Domain d1upud_: 1upu D: [34113]
    complexed with po4, u5p; mutant

Details for d1upud_

PDB Entry: 1upu (more details), 2.5 Å

PDB Description: structure of the uracil phosphoribosyltransferase, mutant c128v, bound to product uridine-1-monophosphate (ump)
PDB Compounds: (D:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1upud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upud_ c.61.1.1 (D:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]}
qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm

SCOPe Domain Coordinates for d1upud_:

Click to download the PDB-style file with coordinates for d1upud_.
(The format of our PDB-style files is described here.)

Timeline for d1upud_: