PDB entry 1upu

View 1upu on RCSB PDB site
Description: structure of the uracil phosphoribosyltransferase, mutant c128v, bound to product uridine-1-monophosphate (ump)
Class: transferase
Keywords: transferase, glycosyltransferase, phosphoribosyltransferase
Deposited on 1998-04-16, released 1999-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.148
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998 (0-223)
      • conflict (63)
      • engineered (107)
      • conflict (136)
    Domains in SCOPe 2.08: d1upua_
  • Chain 'B':
    Compound: uracil phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998 (0-223)
      • conflict (63)
      • engineered (107)
      • conflict (136)
    Domains in SCOPe 2.08: d1upub_
  • Chain 'C':
    Compound: uracil phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998 (0-223)
      • conflict (63)
      • engineered (107)
      • conflict (136)
    Domains in SCOPe 2.08: d1upuc_
  • Chain 'D':
    Compound: uracil phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998 (0-223)
      • conflict (63)
      • engineered (107)
      • conflict (136)
    Domains in SCOPe 2.08: d1upud_
  • Heterogens: PO4, U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upuA (A:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upuB (B:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upuC (C:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upuD (D:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm