Lineage for d5vsoa1 (5vso A:6-75)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303330Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2303366Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2303367Protein automated matches [190750] (8 species)
    not a true protein
  7. 2303371Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [261980] (2 PDB entries)
  8. 2303373Domain d5vsoa1: 5vso A:6-75 [341113]
    Other proteins in same PDB: d5vsoa2
    automated match to d2ocha_

Details for d5vsoa1

PDB Entry: 5vso (more details)

PDB Description: nmr structure of ydj1 j-domain, a cytosolic hsp40 from saccharomyces cerevisiae
PDB Compounds: (A:) Yeast dnaJ protein 1

SCOPe Domain Sequences for d5vsoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vsoa1 a.2.3.0 (A:6-75) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvketkfydilgvpvtatdveikkayrkcalkyhpdknpseeaaekfkeasaayeilsdp
ekrdiydqfg

SCOPe Domain Coordinates for d5vsoa1:

Click to download the PDB-style file with coordinates for d5vsoa1.
(The format of our PDB-style files is described here.)

Timeline for d5vsoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vsoa2