SCOPe 2.08: Domain d5vsoa1: 5vso A:6-75

Lineage for d5vsoa1 (5vso A:6-75)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [261980] (2 PDB entries)

8. Domain d5vsoa1: 5vso A:6-75 [341113]
   Other proteins in same PDB: d5vsoa2
   automated match to d2ocha_

Details for d5vsoa1

PDB Entry: 5vso

PDB Description: nmr structure of ydj1 j-domain, a cytosolic hsp40 from saccharomyces cerevisiae

PDB Compounds: (A:) Yeast dnaJ protein 1

SCOPe Domain Sequences for d5vsoa1:

Sequence; same for both SEQRES and ATOM records:

>d5vsoa1 a.2.3.0 (A:6-75) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvketkfydilgvpvtatdveikkayrkcalkyhpdknpseeaaekfkeasaayeilsdp
ekrdiydqfg

Timeline for d5vsoa1:

• d5vsoa1 first appeared in SCOPe 2.06
  
• d5vsoa1 appears in SCOPe 2.07