Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.0: automated matches [191634] (1 protein) not a true family |
Protein automated matches [191168] (5 species) not a true protein |
Species Piromyces sp. [TaxId:73868] [340898] (15 PDB entries) |
Domain d5nh4d_: 5nh4 D: [340969] automated match to d4xkmf_ complexed with gol, mg, so4 |
PDB Entry: 5nh4 (more details), 1.8 Å
SCOPe Domain Sequences for d5nh4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nh4d_ c.1.15.0 (D:) automated matches {Piromyces sp. [TaxId: 73868]} akeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqf gggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlk avvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagiel gaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptk hqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrg dyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgm damaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkq tsgkqelyeaivamyq
Timeline for d5nh4d_: