SCOPe 2.06: Domain d3l4ia2: 3l4i A:206-399

Lineage for d3l4ia2 (3l4i A:206-399)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (52 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [225813] (2 PDB entries)

8. Domain d3l4ia2: 3l4i A:206-399 [340882]
   automated match to d5fpea2
   complexed with adp, cl, edo, po4

Details for d3l4ia2

PDB Entry: 3l4i

PDB Description: crystal structure of the n-terminal domain of hsp70 (cgd2_20) from cryptosporidium parvum in complex with adp and inorganic phosphate

PDB Compounds: (A:) Heat shock 70 (HSP70) protein

SCOPe Domain Sequences for d3l4ia2:

Sequence; same for both SEQRES and ATOM records:

>d3l4ia2 c.55.1.0 (A:206-399) automated matches {Cryptosporidium parvum [TaxId: 353152]}
tgernvlifdlgggtfdvslltiedgifevkatagdthlggedfdnrlvefcvqdfkrkn
rgmdlttnaralrrlrtqcerakrtlssstqatieldslyegidysvaisrarfeelcad
yfratlapvekvlkdagmdkrsvhdvvlvggstripkvqaliqeffngkepckainpdea
vaygaavqaailng

Timeline for d3l4ia2:

• d3l4ia2 is new in SCOPe 2.06-stable
  
• d3l4ia2 appears in SCOPe 2.07
  
• d3l4ia2 appears in the current release, SCOPe 2.08