Lineage for d5fpea2 (5fpe A:193-385)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137589Protein automated matches [226905] (13 species)
    not a true protein
  7. 2137645Species Human (Homo sapiens) [TaxId:9606] [225574] (46 PDB entries)
  8. 2137730Domain d5fpea2: 5fpe A:193-385 [280443]
    automated match to d1atra2
    complexed with 3tr

Details for d5fpea2

PDB Entry: 5fpe (more details), 1.96 Å

PDB Description: structure of heat shock-related 70kda protein 2 with small- molecule ligand 1h-1,2,4-triazol-3-amine (at485) in an alternate binding site.
PDB Compounds: (A:) heat shock-related 70kda protein 2

SCOPe Domain Sequences for d5fpea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fpea2 c.55.1.1 (A:193-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geknvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvshlaeefkrkhk
kdigpnkravrrlrtacerakrtlssstqasieidslyegvdfytsitrarfeelnadlf
rgtlepvekalrdakldkgqiqeivlvggstripkiqkllqdffngkelnksinpdeava
ygaavqaailigd

SCOPe Domain Coordinates for d5fpea2:

Click to download the PDB-style file with coordinates for d5fpea2.
(The format of our PDB-style files is described here.)

Timeline for d5fpea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fpea1