| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225574] (46 PDB entries) |
| Domain d5fpeb1: 5fpe B:4-188 [280446] automated match to d1atra1 complexed with 3tr |
PDB Entry: 5fpe (more details), 1.96 Å
SCOPe Domain Sequences for d5fpeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fpeb1 c.55.1.1 (B:4-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissmv
ltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaiay
gldkk
Timeline for d5fpeb1: