SCOPe 2.06: Domain d6eimb_: 6eim B:

Lineage for d6eimb_ (6eim B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)

8. Domain d6eimb_: 6eim B: [340870]
   automated match to d4equa_
   complexed with b6e, edo

Details for d6eimb_

PDB Entry: 6eim, 1.43 Å

PDB Description: human stk10 bound to gw683134a

PDB Compounds: (B:) serine/threonine-protein kinase 10

SCOPe Domain Sequences for d6eimb_:

Sequence; same for both SEQRES and ATOM records:

>d6eimb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeeledyivei
eilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqml
ealnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigtpywmape
vvmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllaiaasdpptlltpsk
wsvefrdflaialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevmee

Timeline for d6eimb_:

• d6eimb_ is new in SCOPe 2.06-stable
  
• d6eimb_ appears in SCOPe 2.07
  
• d6eimb_ appears in the current release, SCOPe 2.08