Lineage for d4equa_ (4equ A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein automated matches [190091] (17 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries) 
Domain d4equa_: 4equ A: [194366]
automated match to d2j7ta_
complexed with 1pe, ca, g6i
Details for d4equa_
PDB Entry: 4equ (more details), 2 Å
PDB Description: Human STK-10 (LOK) kinase domain in DFG-out conformation with inhibitor DSA-7
PDB Compounds: (A:) serine/threonine-protein kinase 10SCOPe Domain Sequences for d4equa_:
Sequence, based on SEQRES records: (download)
>d4equa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeeledyiveie
ilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmle
alnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigtpywmapev
vmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskw
svefrdflkialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevmee
Sequence, based on observed residues (ATOM records): (download)
>d4equa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehvrrdldpnevweivgelgkvykaknketgalaaakvieledyiveieilatcdhpyiv
kllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmlealnflhskrii
hrdlkagnvlmtlegdirladfgvsaknligtpywmapevvmcetmkdtpydykadiwsl
gitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflkialdknpetrp
saaqllehpfvssitsnkalrelvaeakaevmee
SCOPe Domain Coordinates for d4equa_:
Click to download the PDB-style file with coordinates for d4equa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4equa_:
- d4equa_ first appeared in SCOPe 2.02
- d4equa_ appears in SCOPe 2.05
- d4equa_ appears in SCOPe 2.07
- d4equa_ appears in the current release, SCOPe 2.08
View in 3D
