SCOPe 2.07: Domain d1tc2b_: 1tc2 B:

Lineage for d1tc2b_ (1tc2 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine PRTase [53286] (4 species)

7. Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries)
   Uniprot Q27796

8. Domain d1tc2b_: 1tc2 B: [34086]
   complexed with 7hp, mg, mn, prp

Details for d1tc2b_

PDB Entry: 1tc2, 1.81 Å

PDB Description: ternary substrate complex of the hypoxanthine phosphoribosyltransferase from trypanosoma cruzi

PDB Compounds: (B:) protein (hypoxanthine phosphoribosyltransferase)

SCOPe Domain Sequences for d1tc2b_:

Sequence; same for both SEQRES and ATOM records:

>d1tc2b_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
reyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlc
ralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltlny
lyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdi
vvlrpevyaereaarq

Timeline for d1tc2b_:

• d1tc2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1tc2b_ appears in SCOPe 2.06
  
• d1tc2b_ appears in the current release, SCOPe 2.08