Lineage for d1tc2b_ (1tc2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891394Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2891430Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries)
    Uniprot Q27796
  8. 2891436Domain d1tc2b_: 1tc2 B: [34086]
    complexed with 7hp, mg, mn, prp

Details for d1tc2b_

PDB Entry: 1tc2 (more details), 1.81 Å

PDB Description: ternary substrate complex of the hypoxanthine phosphoribosyltransferase from trypanosoma cruzi
PDB Compounds: (B:) protein (hypoxanthine phosphoribosyltransferase)

SCOPe Domain Sequences for d1tc2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tc2b_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
reyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlc
ralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltlny
lyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdi
vvlrpevyaereaarq

SCOPe Domain Coordinates for d1tc2b_:

Click to download the PDB-style file with coordinates for d1tc2b_.
(The format of our PDB-style files is described here.)

Timeline for d1tc2b_: