![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Hypoxanthine PRTase [53286] (4 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries) Uniprot Q27796 |
![]() | Domain d1tc2b_: 1tc2 B: [34086] complexed with 7hp, mg, mn, prp |
PDB Entry: 1tc2 (more details), 1.81 Å
SCOPe Domain Sequences for d1tc2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tc2b_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} reyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlc ralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltlny lyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdi vvlrpevyaereaarq
Timeline for d1tc2b_: