SCOP 1.69: Domain d1bzyc_: 1bzy C:

Lineage for d1bzyc_ (1bzy C:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (11 proteins)

6. Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53284] (3 PDB entries)

8. Domain d1bzyc_: 1bzy C: [34073]

Details for d1bzyc_

PDB Entry: 1bzy, 2 Å

PDB Description: human hgprtase with transition state inhibitor

SCOP Domain Sequences for d1bzyc_:

Sequence; same for both SEQRES and ATOM records:

>d1bzyc_ c.61.1.1 (C:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens)}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
dkfvvgyaldyneyfrdlnhvcvisetgkakyka

Timeline for d1bzyc_:

• d1bzyc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bzyc_ appears in SCOP 1.67
  
• d1bzyc_ appears in SCOP 1.71
  
• d1bzyc_ appears in the current release, SCOPe 2.08