Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [53284] (20 PDB entries) |
Domain d1bzyc_: 1bzy C: [34073] complexed with imu, mg, pop |
PDB Entry: 1bzy (more details), 2 Å
SCOPe Domain Sequences for d1bzyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzyc_ c.61.1.1 (C:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip dkfvvgyaldyneyfrdlnhvcvisetgkakyka
Timeline for d1bzyc_: