PDB entry 1bzy

View 1bzy on RCSB PDB site
Description: human hgprtase with transition state inhibitor
Class: phosphoribosyltransferase
Keywords: phosphoribosyltransferase, immucillin, lesch-nyhan, hgprt, transition state, magnesium, pyrophosphate, oxocarbenium ion, neighboring group participation
Deposited on 1998-11-05, released 1999-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bzya_
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bzyb_
  • Chain 'C':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bzyc_
  • Chain 'D':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bzyd_
  • Heterogens: MG, IMU, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bzyA (A:)
    atrspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghh
    ivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggdd
    lstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgf
    eipdkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzyA (A:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bzyB (B:)
    atrspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghh
    ivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggdd
    lstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgf
    eipdkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzyB (B:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bzyC (C:)
    atrspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghh
    ivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggdd
    lstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgf
    eipdkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzyC (C:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bzyD (D:)
    atrspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghh
    ivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggdd
    lstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgf
    eipdkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzyD (D:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka