![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein automated matches [190306] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [322167] (8 PDB entries) |
![]() | Domain d5tnza1: 5tnz A:141-343 [340654] Other proteins in same PDB: d5tnza2, d5tnza3 automated match to d1lcya2 complexed with mes, na; mutant |
PDB Entry: 5tnz (more details), 1.75 Å
SCOPe Domain Sequences for d5tnza1:
Sequence, based on SEQRES records: (download)
>d5tnza1 b.47.1.1 (A:141-343) automated matches {Human (Homo sapiens) [TaxId: 9606]} adprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvv adrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvam gspfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnsggplvnldgevigv ntmkvtagisfaipsdrlreflh
>d5tnza1 b.47.1.1 (A:141-343) automated matches {Human (Homo sapiens) [TaxId: 9606]} adprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvv adrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvam gspfalqntitsgivssaqeyiqtdaaidfgnsggplvnldgevigvntmkvtagisfai psdrlreflh
Timeline for d5tnza1: