Lineage for d5tnza1 (5tnz A:141-343)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794786Protein automated matches [190306] (9 species)
    not a true protein
  7. 2794814Species Human (Homo sapiens) [TaxId:9606] [322167] (8 PDB entries)
  8. 2794819Domain d5tnza1: 5tnz A:141-343 [340654]
    Other proteins in same PDB: d5tnza2, d5tnza3
    automated match to d1lcya2
    complexed with mes, na; mutant

Details for d5tnza1

PDB Entry: 5tnz (more details), 1.75 Å

PDB Description: htra2 s142d mutant
PDB Compounds: (A:) Serine protease HTRA2, mitochondrial

SCOPe Domain Sequences for d5tnza1:

Sequence, based on SEQRES records: (download)

>d5tnza1 b.47.1.1 (A:141-343) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvv
adrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvam
gspfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnsggplvnldgevigv
ntmkvtagisfaipsdrlreflh

Sequence, based on observed residues (ATOM records): (download)

>d5tnza1 b.47.1.1 (A:141-343) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvv
adrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvam
gspfalqntitsgivssaqeyiqtdaaidfgnsggplvnldgevigvntmkvtagisfai
psdrlreflh

SCOPe Domain Coordinates for d5tnza1:

Click to download the PDB-style file with coordinates for d5tnza1.
(The format of our PDB-style files is described here.)

Timeline for d5tnza1: