Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species) |
Species Escherichia coli [TaxId:562] [53280] (5 PDB entries) |
Domain d1ecba1: 1ecb A:250-481 [34063] Other proteins in same PDB: d1ecba2, d1ecbb2, d1ecbc2, d1ecbd2 complexed with 5gp, mg |
PDB Entry: 1ecb (more details), 2.7 Å
SCOPe Domain Sequences for d1ecba1:
Sequence, based on SEQRES records: (download)
>d1ecba1 c.61.1.1 (A:250-481) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtl
>d1ecba1 c.61.1.1 (A:250-481) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia leiarilgkpyrqgfvknryvgrtfimpksvrrklnanraefrdknvllvddsivrgtts eqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqiigadgli fqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtl
Timeline for d1ecba1: