Lineage for d1ecbc1 (1ecb C:250-482)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128284Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (2 species)
  7. 2128294Species Escherichia coli [TaxId:562] [53280] (5 PDB entries)
  8. 2128307Domain d1ecbc1: 1ecb C:250-482 [34065]
    Other proteins in same PDB: d1ecba2, d1ecbb2, d1ecbc2, d1ecbd2
    complexed with 5gp, mg

Details for d1ecbc1

PDB Entry: 1ecb (more details), 2.7 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit
PDB Compounds: (C:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ecbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecbc1 c.61.1.1 (C:250-482) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlr

SCOPe Domain Coordinates for d1ecbc1:

Click to download the PDB-style file with coordinates for d1ecbc1.
(The format of our PDB-style files is described here.)

Timeline for d1ecbc1: