Lineage for d1ecba1 (1ecb A:250-481)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.61: PRTase-like [53270] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.61.1: PRTase-like [53271] (3 families) 
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) 
Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species) Species Escherichia coli [TaxId:562] [53280] (5 PDB entries) 
Domain d1ecba1: 1ecb A:250-481 [34063]
Other proteins in same PDB: d1ecba2, d1ecbb2, d1ecbc2, d1ecbd2
complexed with 5gp, mg
Details for d1ecba1
PDB Entry: 1ecb (more details), 2.7 Å
PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit
PDB Compounds: (A:) glutamine phosphoribosylpyrophosphate amidotransferaseSCOPe Domain Sequences for d1ecba1:
Sequence, based on SEQRES records: (download)
>d1ecba1 c.61.1.1 (A:250-481) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtl
Sequence, based on observed residues (ATOM records): (download)
>d1ecba1 c.61.1.1 (A:250-481) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpksvrrklnanraefrdknvllvddsivrgtts
eqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqiigadgli
fqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtl
SCOPe Domain Coordinates for d1ecba1:
Click to download the PDB-style file with coordinates for d1ecba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ecba1:
View in 3D
