Lineage for d1ecjd1 (1ecj D:250-492)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891358Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species)
  7. 2891368Species Escherichia coli [TaxId:562] [53280] (5 PDB entries)
  8. 2891378Domain d1ecjd1: 1ecj D:250-492 [34062]
    Other proteins in same PDB: d1ecja2, d1ecjb2, d1ecjc2, d1ecjd2
    complexed with amp

Details for d1ecjd1

PDB Entry: 1ecj (more details), 2.5 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 amp per tetramer
PDB Compounds: (D:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ecjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecjd1 c.61.1.1 (D:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav
qrq

SCOPe Domain Coordinates for d1ecjd1:

Click to download the PDB-style file with coordinates for d1ecjd1.
(The format of our PDB-style files is described here.)

Timeline for d1ecjd1: