PDB entry 1ecj

View 1ecj on RCSB PDB site
Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 amp per tetramer
Class: transferase
Keywords: transferase, glutamine amidotransferase, purine biosynthesis, glycosyltransferase, amp, adenine 5'-monophosphate
Deposited on 1997-07-16, released 1998-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecja1, d1ecja2
  • Chain 'B':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecjb1, d1ecjb2
  • Chain 'C':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecjc1, d1ecjc2
  • Chain 'D':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecjd1, d1ecjd2
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ecjA (A:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlemhneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecjA (A:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ecjB (B:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlemhneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecjB (B:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ecjC (C:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlemhneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecjC (C:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ecjD (D:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlemhneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecjD (D:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrq